Human Epidermal Growth Factor (hEGF) 1mg
BBSHEGF1MG
C$80.00
Excluding GST/HST
RUO Product (Research Use Only)
Epidermal growth factor (EGF) is a small, potent growth factor capable of inducing proliferation, differentiation, and survival of numerous cell types.
HOMG4 (URG) gene encodes a member of the epidermal growth factor superfamily. The HOMG4 encoded pre-proprotein is proteolytically processed to generate the 53-amino acid epidermal growth factor peptide which is thought to be involved in mechanisms such as normal cell growth, oncogenesis, and wound healing.
EGF is the founding member of the EGF family that also includes TGF-alpha, amphiregulin (AR), betacellulin (BTC), epiregulin (EPR), heparin‐binding EGF‐like growth factor (HB‐EGF), epigen, and the neuregulins (NRG)-1 through -6 (1).
Members of The EGF family are characterized by a shared structural motif, the EGF‐like domain, which contains three intramolecular di-sulfide bonds that are formed by six similarly spaced, conserved cysteine residues (2). These di-sulfide bonds are essential for proper protein conformation and receptor binding.
EGF receptors are expressed in almost all types of tissues. The EGF receptor, designated HER1, is a 170 kDa transmembrane glycoprotein with a length of 1186 amino acids.
Quantity
Specification
Gene Aliases: HOMG4; URG
Accession number: P01133
Amino acid sequence: (EA)NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELRYPYDVPDYA
Species: Human (H. sapiens)
Expression Host / source: Yeast (animal free media and environment)
Tag: HA tag (C-terminus); Glu-Ala (N-terminus)
Endotoxins: <0.2 EU/μg of protein as determined by the LAL method.
Buffer System: Phosphate -buffered saline (PBS),
pH 7.4
Approx. MW: 7.4 kDa
Purity: 98%
Formulation: lyophilized from solution in PBS buffer
Bioactivity
The biological activity of Human Recombinant EGF was tested by its ability to promote the proliferation of BALB/c 3T3 cells.
Cell proliferation was measured using a fluorometric assay method. The EC50 is defined as the effective concentration of the growth factor at which cell proliferation is at 50% of maximum, which is <0.1ng/ml
Reconstitution protocol: Spin the vial briefly, add distilled
sterile water to a concentration of 0.1ml/ml.
Storage and Stability
Lyophilized EGF is stable for at least one year at -20 oC. Upon reconstitution EGF can be stored at +40C for 2 weeks or at -20 oC for 6 months.
References:
1. Harris, R.C. et al. (2003) Exp. Cell Res. 284:
2. Carpenter, G. and Cohen, S. (1990) J. Biol. Chem. 265:7709.