Recombinant Human Serum Albumin (rHSA) 1mg
C$220.00
Excluding GST/HST
RUO Product (Research Use Only)
Human serum albumin (HSA) is a crucial protein found in the blood plasma, accounting for a significant portion of the total protein content. Comprising about 60% of the total plasma proteins, HSA is synthesized by the liver and plays a vital role in maintaining osmotic pressure, transporting various substances, and contributing to the overall physiological balance within the circulatory system. This globular protein has a molecular weight of approximately 66.5 kDa and is composed of a single polypeptide chain with 585 amino acid residues.
Due to its multifunctional nature, human serum albumin has widespread applications in medicine and biotechnology. It is commonly used in the pharmaceutical industry as a stabilizing agent for vaccines and as a carrier for drug delivery systems. Furthermore, HSA has found utility in clinical settings, where it is administered as an intravenous therapeutic agent to address conditions associated with hypoalbuminemia, such as severe burns or liver diseases. The versatility and significance of human serum albumin underscore its pivotal role in maintaining homeostasis within the human body and its valuable applications in various scientific and medical fields.
Quantity
Specifications
Gene Aliases: HOMG4; URG
Accession number: P01133
Amino acid sequence: (EA)NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELRYPYDVPDYA
Species: Human (H. sapiens)
Expression Host / source: Yeast (animal free media and environment)
Tag: HA tag (C-terminus); Glu-Ala (N-terminus)
Endotoxins: <0.2 EU/μg of protein as determined by the LAL method.
Buffer System: Phosphate -buffered saline (PBS),
pH 7.4
Approx. MW: 7.4 kDa
Purity: 98%
Formulation: lyophilized from solution in PBS buffer
Storage and Stability
Lyophilized rHSA is stable for at least one year at -20 oC. Upon reconstitution rHSA can be stored at +40C for 2 weeks or at -20 oC for 6 months.